DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and Rab8

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster


Alignment Length:178 Identity:76/178 - (42%)
Similarity:110/178 - (61%) Gaps:4/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            ||..||::::|||||||||:|.|||::.|.|...||:|:|.:..::|..:.::  .||:|||:..
  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKI--KLQIWDTAGQ 67

  Fly    69 ERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVS 133
            |||:.:...:.|.|.||:||||||..|||:||..|::.|.......|..:|:|||.:..:.||||
  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132

  Fly   134 MAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI--YTYRRVHYN 179
            ..:|...|....|.|.|.|||:..||.:.|.:||.||  .|.:|:..|
  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEAN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 71/164 (43%)
Rab 8..167 CDD:206640 67/158 (42%)
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 72/167 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.