DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and Rab33b

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001102414.1 Gene:Rab33b / 365793 RGDID:1308353 Length:229 Species:Rattus norvegicus


Alignment Length:199 Identity:69/199 - (34%)
Similarity:109/199 - (54%) Gaps:24/199 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDDERFK 72
            ||||::|||.||||||..||...:|..|..:|:|:|.||.:|:....|:  .:|:|||:..|||:
  Rat    34 FKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERI--KIQLWDTAGQERFR 96

  Fly    73 LLKATH-CRSAHGILLVYDITSSKSFQNIDGWMKEIRR-LCPDKVIVLLVGNKSDDPNHRQV--S 133
            .....| .|:.|.::.|||:|:..||.::..|::|.:: |..:.:..:|||||.|..:..||  .
  Rat    97 KSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTD 161

  Fly   134 MAQGFNYAHRQSICFEEVSAKS---GRNVYDIFSSLAMDIYTYR----------RVHYNPF---S 182
            :||.|...|  |:...|.|||:   ..:|..||.:||..:.:::          |:...|.   :
  Rat   162 LAQKFADTH--SMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQLPDNRISLKPETKPA 224

  Fly   183 LTSW 186
            :|.|
  Rat   225 VTCW 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 65/169 (38%)
Rab 8..167 CDD:206640 63/165 (38%)
Rab33bNP_001102414.1 Rab33B_Rab33A 32..201 CDD:133315 65/170 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.