DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and Rab21

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:199 Identity:66/199 - (33%)
Similarity:108/199 - (54%) Gaps:12/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTL--GMDRRECSVEFADWRMGRMLQVWDTSDDER 70
            ||.::||:..||||.|::|:.:::|..:|.|||  ....|:.|:|  |.|..: |.:|||:..||
  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLE--DGRRAQ-LNIWDTAGQER 75

  Fly    71 FKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMA 135
            |..|...:.|.:.|.|||||||...|||.:..|::|:|::...::.:::||||:|....|.|:..
  Fly    76 FHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHD 140

  Fly   136 QGFNYAHRQSICFEEVSAKSGRNVYDIF---SSLAMDIYTYRRVHYNPFSL----TSWQEEEDAA 193
            :...||......:.|.|||....|.::|   :.|.::..:.|:...:|..|    |......|.:
  Fly   141 EALQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTDNLNNSDDS 205

  Fly   194 ESLD 197
            |:.|
  Fly   206 EAPD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 59/167 (35%)
Rab 8..167 CDD:206640 58/163 (36%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 59/164 (36%)
Ras 15..177 CDD:278499 58/164 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.