DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and Rab8b

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:XP_038936858.1 Gene:Rab8b / 266688 RGDID:628764 Length:208 Species:Rattus norvegicus


Alignment Length:170 Identity:76/170 - (44%)
Similarity:105/170 - (61%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            ||..||::::|||||||||||.|||::.|.|...||:|:|.:..::|....::  .||:|||:..
  Rat     5 YDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKI--KLQIWDTAGQ 67

  Fly    69 ERFKLLKATHCRSA-HGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQV 132
            |||:.:...:.|.| .||:||||||:.|||.||..|::.|.......|..:::|||.|..:.|||
  Rat    68 ERFRTITTAYYRGAMQGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQV 132

  Fly   133 SMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYT 172
            |..:|...|....|.|.|.||||..||.:.|.:||.||.|
  Rat   133 SKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMT 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 72/163 (44%)
Rab 8..167 CDD:206640 69/159 (43%)
Rab8bXP_038936858.1 Rab8_Rab10_Rab13_like 6..173 CDD:206659 75/169 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.