DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and ypt2

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_594580.1 Gene:ypt2 / 2543280 PomBaseID:SPAC9E9.07c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:72/179 - (40%)
Similarity:107/179 - (59%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            ||...|::::|||||||:|||:|||::.||....:|:|:|.:..::|....|:  .||:|||:..
pombe     6 YDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRI--KLQIWDTAGQ 68

  Fly    69 ERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVS 133
            |||:.:...:.|.|.||||:||:|..|||.|:..|...:.:...:.|..:|:|||.|..:.||||
pombe    69 ERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILIGNKCDCEDQRQVS 133

  Fly   134 MAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFS 182
            ..||...|....:.|.|.|||:..||.:.|.:||.:|...:....|.||
pombe   134 FEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 66/162 (41%)
Rab 8..167 CDD:206640 64/158 (41%)
ypt2NP_594580.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 68/167 (41%)
Ras 11..172 CDD:278499 67/162 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.