DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and Rabl6

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001019787.2 Gene:Rabl6 / 227624 MGIID:2442633 Length:725 Species:Mus musculus


Alignment Length:157 Identity:38/157 - (24%)
Similarity:65/157 - (41%) Gaps:38/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGR-----MLQV 62
            ||:  .||:|.||...|||.|..|....:|...:..|     :|..|....|....     .::|
Mouse    41 QYN--MKIVIRGDRNTGKTALWHRLQGKKFVEEYIPT-----QEIQVTSIHWNYKTTDDVVKVEV 98

  Fly    63 WDTSDDERFKL----LKATH------------------CRSAHGILLVYDITSSKSFQNIDGWMK 105
            ||..|..:.|.    ||..:                  .::.:|:::::|||...:|..:   ::
Mouse    99 WDVVDKGKCKKRGDGLKTENDPQEAESELALDAEFLDVYKNCNGVVMMFDITKQWTFNYV---LR 160

  Fly   106 EIRRLCPDKVIVLLVGNKSDDPNHRQV 132
            |:.:: |..|.|.::||..|...||.:
Mouse   161 ELPKV-PTHVPVCVLGNYRDMGEHRVI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 36/152 (24%)
Rab 8..167 CDD:206640 36/152 (24%)
Rabl6NP_001019787.2 Small GTPase-like 39..279 38/157 (24%)
P-loop_NTPase 44..221 CDD:304359 36/152 (24%)
Ras 45..221 CDD:278499 36/151 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..364
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..725
Interaction with CDKN2A. /evidence=ECO:0000250 652..690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.