DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and Rab1a

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_033022.1 Gene:Rab1a / 19324 MGIID:97842 Length:205 Species:Mus musculus


Alignment Length:170 Identity:69/170 - (40%)
Similarity:107/170 - (62%) Gaps:6/170 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGR--MLQVWDT 65
            :||..||::::|||||||:|||:||:|:.:|..:.||:|:|.:..::|..    |:  .||:|||
Mouse     7 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELD----GKTIKLQIWDT 67

  Fly    66 SDDERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130
            :..|||:.:.:::.|.||||::|||:|..:||.|:..|::||.|...:.|..||||||.|....:
Mouse    68 AGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKK 132

  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            .|.......:|....|.|.|.|||:..||...|.::|.:|
Mouse   133 VVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 67/165 (41%)
Rab 8..167 CDD:206640 65/160 (41%)
Rab1aNP_033022.1 Rab1_Ypt1 10..175 CDD:206661 67/167 (40%)
Effector region. /evidence=ECO:0000255 40..48 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.