DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab9E and rab-8

DIOPT Version :9

Sequence 1:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_491199.2 Gene:rab-8 / 171935 WormBaseID:WBGene00004272 Length:211 Species:Caenorhabditis elegans


Alignment Length:167 Identity:69/167 - (41%)
Similarity:102/167 - (61%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSDD 68
            ||..||::::|||||||||:|.||||:.|.....||:|:|.:..::|....::  .||:|||:..
 Worm     5 YDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKI--KLQIWDTAGQ 67

  Fly    69 ERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVS 133
            |||:.:...:.|.|.||:||||||:.:||:||..|::.|.......|..:::|||.|....|:||
 Worm    68 ERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVS 132

  Fly   134 MAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170
            ..:|...|......|.|.|||:..|:.:.|.:||.||
 Worm   133 RDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab9ENP_727438.1 RAB 8..171 CDD:197555 67/163 (41%)
Rab 8..167 CDD:206640 63/158 (40%)
rab-8NP_491199.2 Rab8_Rab10_Rab13_like 6..172 CDD:206659 68/166 (41%)
RAB 9..172 CDD:197555 67/163 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.