DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32668 and PKP4

DIOPT Version :9

Sequence 1:NP_727502.1 Gene:CG32668 / 318147 FlyBaseID:FBgn0052668 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_001364147.1 Gene:PKP4 / 8502 HGNCID:9026 Length:1192 Species:Homo sapiens


Alignment Length:747 Identity:149/747 - (19%)
Similarity:232/747 - (31%) Gaps:294/747 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRSETRPQANP-AEMAKQPADS-------DKSDRQQQ-----LAKHHQMRHH--------QPHAS 52
            |||.|  |.|. ::...|.|.|       .|:|.:||     ...:|.:|:.        ||..:
Human   143 SRSST--QMNSYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVA 205

  Fly    53 EQSLNKLGLVSSGTSGMGRRKTSAELISEAKMFLGESVNAVPL---LATG-GARLVSTRRPITPR 113
            .:::.::..|.|      |.::.:.:||     .|.|.:...|   |.:| |:..|:..||:.|.
Human   206 NRAMRRVSSVPS------RAQSPSYVIS-----TGVSPSRGSLRTSLGSGFGSPSVTDPRPLNPS 259

  Fly   114 ESGRVLYGKVAL-AGRPPSAFSMRYLQNEKPSTPRQLPALSGSVSATPMPTRNGALLCQSSTETL 177
                 .|....| |.|..|.:|.|      |::|..:..: |||::......||.          
Human   260 -----AYSSTTLPAARAASPYSQR------PASPTAIRRI-GSVTSRQTSNPNGP---------- 302

  Fly   178 IELLKQHSGLKDCSDETVQHINA--ILQELYTRVRKQERNYKRGFILGGLYGLVECTSPRVLLAV 240
               ..|:        :|...:.:  .|.:..|||....:            |.|..:||:     
Human   303 ---TPQY--------QTTARVGSPLTLTDAQTRVASPSQ------------GQVGSSSPK----- 339

  Fly   241 ARVVLALRVTGSNLTGACKLIFKVARHEQHD-ALF--HEHDVLELLIDGLGHASPLDEPEACIYA 302
                      .|.:|...:.:....:...|| ..|  .::|:.|.::                  
Human   340 ----------RSGMTAVPQHLGPSLQRTVHDMEQFGQQQYDIYERMV------------------ 376

  Fly   303 YGCIRFLTASSAQERDDALNRNWIGLETSGESQSLPIPALMPPALSAISTSLCPRKLTGQQTLVS 367
                        ..|.|:|.    ||.:|..||.   ..|.....||:|..|....:...:|..|
Human   377 ------------PPRPDSLT----GLRSSYASQH---SQLGQDLRSAVSPDLHITPIYEGRTYYS 422

  Fly   368 ---RLARHGAVELMILHLQMLNEAGATKRLQGPPLHTLYQLSAAMRALADVSQQQQRLQLQLQLA 429
               |...||.||                 |||.                             |.|
Human   423 PVYRSPNHGTVE-----------------LQGS-----------------------------QTA 441

  Fly   430 CPHLIRAAEVSMGELEVQANVVRTLSVLSEDSDCCETLHNYAARIGLLLGPSCAGGGQWSERLLA 494
               |.|...|.:|.|:      ||.                                  |:|...
Human   442 ---LYRTGSVGIGNLQ------RTS----------------------------------SQRSTL 463

  Fly   495 VLSRLGYMLGNILAKHESAR-IQYFHNDVAMEYLLNVLEQLNERSPSSVAHLDAQIKLIRVVANM 558
            ...|..|.|.......|..| |||               ::.|.:.:.:.|              
Human   464 TYQRNNYALNTTATYAEPYRPIQY---------------RVQECNYNRLQH-------------- 499

  Fly   559 SVNPEVGAGLGNVRSLGAVLLQLLSKTSEELTKKKSPEQQELLH----------ATLGA-LHNLC 612
                .|.|..|..||..   :..:.|...|.. .:.||..|::|          |...| |.:||
Human   500 ----AVPADDGTTRSPS---IDSIQKDPREFA-WRDPELPEVIHMLQHQFPSVQANAAAYLQHLC 556

  Fly   613 FYQDKQAAVQPLAEGSLQSLIDDLSASLAKVLGNCQTSVTKVELARVLGNLT-RNEQARRCFCAA 676
            | .|.:..::....|.::.|:|.|...:.:|..|...::..:    |.|..| .|:.|.:   ..
Human   557 F-GDNKVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRNL----VFGKSTDENKIAMK---NV 613

  Fly   677 GGLPLMVQQLTKQAAGQDYELRTCAIGVLVNL 708
            ||:|.:::.|.|..   |.|:|....|||.||
Human   614 GGIPALLRLLRKSI---DAEVRELVTGVLWNL 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32668NP_727502.1 armadillo repeat 571..611 CDD:293788 11/50 (22%)
armadillo repeat 619..665 CDD:293788 9/46 (20%)
armadillo repeat 670..708 CDD:293788 11/37 (30%)
PKP4NP_001364147.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..262 32/136 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..310 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..348 9/51 (18%)
ARM 1 415..455 17/94 (18%)
ARM 2 518..557 10/39 (26%)
ARM 3 560..599 6/42 (14%)
ARM 4 604..644 15/45 (33%)
ARM 5 660..702
ARM 6 706..751
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 773..810
ARM 7 815..855
ARM 8 862..901
ARM 9 950..993
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1058..1086
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.