DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32668 and pkp4

DIOPT Version :9

Sequence 1:NP_727502.1 Gene:CG32668 / 318147 FlyBaseID:FBgn0052668 Length:863 Species:Drosophila melanogaster
Sequence 2:XP_690071.3 Gene:pkp4 / 561566 ZFINID:ZDB-GENE-120411-14 Length:1136 Species:Danio rerio


Alignment Length:747 Identity:159/747 - (21%)
Similarity:230/747 - (30%) Gaps:251/747 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRRRSRSETRPQANPAEMAKQPADSDKSDRQQQLAKHHQMRHHQPHASEQSLNKLGLV--SSGTS 67
            |.|....|.:..||..|..:..|:|                   |.|:..|.::..|:  |:.:|
Zfish    51 LTRELEEERQIVANQLERCRLGAES-------------------PGAASDSSSEKSLLWRSAESS 96

  Fly    68 GMGRRKTSAELISEAKMFLGE------SVNAVPLLATGG--ARLVSTRRPITPRESGRVLYGKVA 124
            |.|..|.|....|......|:      .:..:.|..:.|  |...|:.:..:..:||   |.:|:
Zfish    97 GAGVSKPSDGCPSPTFGVRGQGSLYSPELEQISLRESEGSAANSRSSTQMNSYSDSG---YQEVS 158

  Fly   125 LAGRPPSAFSMRYLQNEKPSTPRQLPALSGSVSATP--MPTRNGALLCQSSTETLIELLKQHSGL 187
                       .|..|  ..|||:....|.|.|:.|  .||    |...|..|      .|.|..
Zfish   159 -----------GYYSN--TVTPRRSEGRSQSTSSAPSGSPT----LAMSSRAE------GQASAQ 200

  Fly   188 KDCSDETVQHINAILQE----LYTRVRKQERNYKRGFILGGLYGLVECTSPRVLLAVARVVLALR 248
            ...|...::.::::...    |||......|...| ..||..||....:.||.|.::        
Zfish   201 VGSSGRVMRRVSSVPSRAPSPLYTPSPPASRQPLR-TSLGSPYGSPIVSEPRPLPSI-------- 256

  Fly   249 VTGSNLTGACKLIFKVARHEQHDALFHEHDVLELLIDGLGHASPLDEPEACIYAYGCIRFLTASS 313
            ..|:.|..|.    ..|....|.:....|        |.|..|....|  .:...|    :||..
Zfish   257 FPGTTLPPAS----SHAPDPLHSSYLGRH--------GNGTGSESGSP--TLLRAG----MTAQP 303

  Fly   314 AQ-----ERDDALNRNWIGLETSGESQSLPIPALM----PPALSAISTSLCPRKLTGQQTLVSRL 369
            .|     :.|   .|.:....:|..|::..|...|    |.:|:.:.||.......||.|     
Zfish   304 QQYGTLGKHD---TRAYESTHSSFGSRAYDIFERMVLSRPDSLTGLQTSYSQNSQLGQDT----- 360

  Fly   370 ARHGAVELMILHLQMLNEAGATKRLQGPPLHTLYQ------LSAAMR------ALADVSQQQQRL 422
                  .....|:..:.|   .:..|.|    |||      .|||.|      .|...:.|...|
Zfish   361 ------RSPDCHVTPIYE---DRTFQNP----LYQSPTHGSQSAASRNNTGFGTLQRTTSQCSTL 412

  Fly   423 QLQLQLACPHLIRAAEVSMGELEVQANVVRTLSVLSEDSDCCETLHNYAARIGLLLGPSCAGGGQ 487
            :.|..|          .|||.:...::..|.......||       ||                 
Zfish   413 RYQRGL----------FSMGSMATHSDTYRPGHYRQADS-------NY----------------- 443

  Fly   488 WSERLLAVLSRLGYMLGNILAKHESARIQYFHNDVAMEY------LLNVLEQLNERSPSSVAHLD 546
                     ||....|.|.:.:  |..|...|.| ..|:      |..|:..|....||..|:..
Zfish   444 ---------SRHSAALDNAVTR--SPSIDSVHKD-PREFAWRDPELPEVIRMLQHHFPSVQANAA 496

  Fly   547 AQIKLIRVVANMSVNPEVGAGLGNVRSLGAVLLQLLSKTSEELTKKKSPEQQELLHATLGALHNL 611
            |.|:.: ...:..:..|| ..||.:|.    |:.||.                  |.||....|.
Zfish   497 AYIQHL-CYGDNRIKAEV-CRLGGIRH----LVDLLD------------------HKTLEVQRNA 537

  Fly   612 CFYQDKQAAVQPLAEGSLQSLIDDLSASLAKVLGNCQTSVTKVELARVLGNLTRNEQARRCFCAA 676
            |              |:|::|                          |.|..|.:.:.  |...:
Zfish   538 C--------------GALRNL--------------------------VYGKATDDNKV--CVRNS 560

  Fly   677 GGLPLMVQQLTKQAAGQDYELRTCAIGVLVNL 708
            ||:|.:|:.|.|.   .|.|:|....|||.||
Zfish   561 GGIPALVRLLRKT---PDSEVRELVTGVLWNL 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32668NP_727502.1 armadillo repeat 571..611 CDD:293788 7/39 (18%)
armadillo repeat 619..665 CDD:293788 5/45 (11%)
armadillo repeat 670..708 CDD:293788 13/37 (35%)
pkp4XP_690071.3 DUF966 <105..>252 CDD:283735 37/173 (21%)
ARM 469..591 CDD:237987 43/190 (23%)
armadillo repeat 477..502 CDD:293788 8/24 (33%)
HEAT_2 506..580 CDD:290374 28/141 (20%)
armadillo repeat 510..546 CDD:293788 16/98 (16%)
armadillo repeat 554..589 CDD:293788 13/39 (33%)
armadillo repeat 595..647 CDD:293788
ARM 636..>699 CDD:237987
armadillo repeat 765..802 CDD:293788
ARM 766..893 CDD:237987
armadillo repeat 812..846 CDD:293788
armadillo repeat 853..893 CDD:293788
armadillo repeat 899..934 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.