DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32668 and ARVCF

DIOPT Version :9

Sequence 1:NP_727502.1 Gene:CG32668 / 318147 FlyBaseID:FBgn0052668 Length:863 Species:Drosophila melanogaster
Sequence 2:XP_006724306.1 Gene:ARVCF / 421 HGNCID:728 Length:1004 Species:Homo sapiens


Alignment Length:279 Identity:69/279 - (24%)
Similarity:103/279 - (36%) Gaps:69/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 PLAE---GSLQSL---------IDDL-------SASLAKVLGNCQTSV--TKVELARVLGNLT-R 665
            |||:   ||:.||         :|..       ...|.:||...:..|  .|...|..|.:|. .
Human   324 PLAQPERGSMGSLDRLVRRSPSVDSARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFE 388

  Fly   666 NEQARRCFCAAGGLPLMVQQLTKQAAGQDYELRTCAIGVLVNLL--GDGEQRGPFLQLRGAELLS 728
            ||..:|......||||:|..|....|    |:|..|.|.|.||.  .|.:.:.......|...|.
Human   389 NEGVKRRVRQLRGLPLLVALLDHPRA----EVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALV 449

  Fly   729 LLLRGSLEQEDWFLANIVCQALWNLLIDGHCAANLCQSSNILDEVSDLLADY----LDEDRLSPG 789
            .|||.:.:.|   :..:|...||||              :..:.:..::.|:    |..:.:.|.
Human   450 RLLRAARDNE---VRELVTGTLWNL--------------SSYEPLKMVIIDHGLQTLTHEVIVPH 497

  Fly   790 DD-DNDNDEDDPEREAEDL-----------DASDTDPEAHDALWEDFALVATDLLERIQNNFDRQ 842
            .. :.:.:||...|:||..           :.|....||...|.|...||.. ||..:|:...| 
Human   498 SGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDA-LLHALQSAVGR- 560

  Fly   843 QQSLPQNADNED-DNDVFI 860
                 ::.||:. :|.|.|
Human   561 -----KDTDNKSVENCVCI 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32668NP_727502.1 armadillo repeat 571..611 CDD:293788
armadillo repeat 619..665 CDD:293788 16/63 (25%)
armadillo repeat 670..708 CDD:293788 13/37 (35%)
ARVCFXP_006724306.1 ARM 355..473 CDD:237987 37/138 (27%)
HEAT_2 360..462 CDD:290374 32/108 (30%)
armadillo repeat 360..385 CDD:293788 7/24 (29%)
armadillo repeat 393..429 CDD:293788 15/39 (38%)
armadillo repeat 436..471 CDD:293788 9/37 (24%)
ARM 437..579 CDD:237987 35/162 (22%)
armadillo repeat 478..529 CDD:293788 8/50 (16%)
ARM 656..756 CDD:237987
armadillo repeat 656..692 CDD:293788
armadillo repeat 702..736 CDD:293788
armadillo repeat 743..788 CDD:293788
armadillo repeat 794..826 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.