DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32668 and p120ctn

DIOPT Version :9

Sequence 1:NP_727502.1 Gene:CG32668 / 318147 FlyBaseID:FBgn0052668 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_001036444.1 Gene:p120ctn / 3355143 FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster


Alignment Length:327 Identity:80/327 - (24%)
Similarity:129/327 - (39%) Gaps:76/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 IQYFHNDV--AMEY----LLNVLEQLNERSPSSVAHLDAQIKLIRVVANMSVNPEVGAGLGNVRS 573
            |:...||:  .|.:    |..|:..|:  :|||....:|...|..:......|.:      ..||
  Fly   209 IEGSENDICSTMRWRDPNLSEVISFLS--NPSSAIKANAAAYLQHLCYMDDPNKQ------RTRS 265

  Fly   574 LGAV--LLQLLSKTSEELTKKKSPEQQELLHATLGALHNLCFYQDKQAAVQPLAE-GSLQSLIDD 635
            ||.:  |::|||..|.|:.|.           ..|||.||.:.:......:.:.. |.:.:|:..
  Fly   266 LGGIPPLVRLLSYDSPEIHKN-----------ACGALRNLSYGRQNDENKRGIKNAGGIAALVHL 319

  Fly   636 LSASLAKVLGNCQTSVTKVE--LARVLGNLTRNEQARRCFCAAGGLPLMVQQLTKQAAGQDYEL- 697
            |          |::..|:|:  :..||.|::..|..:|..... .|..:|..:.|..:|.|... 
  Fly   320 L----------CRSQETEVKELVTGVLWNMSSCEDLKRSIIDE-ALVAVVCSVIKPHSGWDAVCC 373

  Fly   698 -RTC-------AIGVLVNLLGDGEQ-RGPFLQLRGAE-LLSLLL---RGSLEQEDWFLANIVCQA 749
             .||       |.|||.|:...||. ||   .||..| |:..||   |.|:|:.:          
  Fly   374 GETCFSTVFRNASGVLRNVSSAGEHARG---CLRNCEHLVECLLYVVRTSIEKNN---------- 425

  Fly   750 LWNLLIDGHCAANLCQSSNILDEVSDLLAD---YLDEDRLSPGDDDNDN----DEDDPEREAEDL 807
            :.|..:: :|...|...|....||.|...|   ::..:|:.|.....:|    ..:..::||.:.
  Fly   426 IGNKTVE-NCVCILRNLSYRCQEVDDPNYDKHPFITPERVIPSSSKGENLGCFGTNKKKKEANNS 489

  Fly   808 DA 809
            ||
  Fly   490 DA 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32668NP_727502.1 armadillo repeat 571..611 CDD:293788 14/41 (34%)
armadillo repeat 619..665 CDD:293788 9/48 (19%)
armadillo repeat 670..708 CDD:293788 12/46 (26%)
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 34/142 (24%)
armadillo repeat 227..252 CDD:293788 8/26 (31%)
armadillo repeat 260..296 CDD:293788 16/52 (31%)
armadillo repeat 304..339 CDD:293788 8/44 (18%)
ARM 307..442 CDD:237987 39/159 (25%)
armadillo repeat 347..392 CDD:293788 12/45 (27%)
armadillo repeat 515..556 CDD:293788
ARM 516..643 CDD:237987
armadillo repeat 562..596 CDD:293788
armadillo repeat 601..641 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1048
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.