DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32668 and Arvcf

DIOPT Version :9

Sequence 1:NP_727502.1 Gene:CG32668 / 318147 FlyBaseID:FBgn0052668 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_001124485.1 Gene:Arvcf / 303798 RGDID:1306655 Length:973 Species:Rattus norvegicus


Alignment Length:340 Identity:82/340 - (24%)
Similarity:121/340 - (35%) Gaps:96/340 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 PEVGAGLGNVRSLGAVLLQLLSKTSEELTKKKSPEQQELLHATLGALHNLCFYQDKQAAVQPLAE 626
            ||.|      |.|.|..|:..:..:.||.:::.|                     ..||..|||:
  Rat   291 PEYG------RGLRARALEDTADDTGELVEERPP---------------------FPAATAPLAQ 328

  Fly   627 ---GSLQSL---------IDDL-------SASLAKVLGNCQTSV--TKVELARVLGNLT-RNEQA 669
               |||.||         :|..       ...|.:||...:..|  .|...|..|.:|. .||..
  Rat   329 PERGSLGSLDRVVRRSPSVDSTRKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGI 393

  Fly   670 RRCFCAAGGLPLMVQQLTKQAAGQDYELRTCAIGVLVNLL--GDGEQRGPFLQLRGAELLSLLLR 732
            :|......||||:|..|....|    |:|..|.|.|.||.  .|.:.:.......|...|..|||
  Rat   394 KRRVRQLRGLPLLVALLDHPRA----EVRRRACGALRNLSYGRDADNKAAIRDCGGVPALVRLLR 454

  Fly   733 GSLEQEDWFLANIVCQALWNLLIDGHCAANLCQSSNILDEVSDLLADY----LDEDRLSPGDD-D 792
            .:.:.|   :..:|...||||              :..:.:..::.|:    |..:.:.|... :
  Rat   455 AARDNE---VRELVTGTLWNL--------------SSYEPLKMVIIDHGLQTLTHEVIVPHSGWE 502

  Fly   793 NDNDEDDPEREAEDL-----------DASDTDPEAHDALWEDFALVATDLLERIQNNFDRQQQSL 846
            .:.:||...|:||..           :.|....||...|.|...||.. ||..:|:...|     
  Rat   503 REPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDA-LLHALQSAVGR----- 561

  Fly   847 PQNADNED-DNDVFI 860
             ::.||:. :|.|.|
  Rat   562 -KDTDNKSVENCVCI 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32668NP_727502.1 armadillo repeat 571..611 CDD:293788 7/39 (18%)
armadillo repeat 619..665 CDD:293788 19/67 (28%)
armadillo repeat 670..708 CDD:293788 13/37 (35%)
ArvcfNP_001124485.1 ARM 356..474 CDD:237987 37/138 (27%)
HEAT_2 361..463 CDD:290374 32/108 (30%)
armadillo repeat 361..386 CDD:293788 7/24 (29%)
armadillo repeat 394..430 CDD:293788 15/39 (38%)
armadillo repeat 437..472 CDD:293788 9/37 (24%)
ARM 438..580 CDD:237987 35/162 (22%)
armadillo repeat 479..530 CDD:293788 8/50 (16%)
ARM 651..751 CDD:237987
armadillo repeat 651..687 CDD:293788
armadillo repeat 697..731 CDD:293788
armadillo repeat 738..783 CDD:293788
armadillo repeat 789..821 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.