DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32668 and Pkp3

DIOPT Version :9

Sequence 1:NP_727502.1 Gene:CG32668 / 318147 FlyBaseID:FBgn0052668 Length:863 Species:Drosophila melanogaster
Sequence 2:XP_008758204.1 Gene:Pkp3 / 293619 RGDID:1309133 Length:836 Species:Rattus norvegicus


Alignment Length:986 Identity:198/986 - (20%)
Similarity:301/986 - (30%) Gaps:376/986 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SETRPQANPAEMA--------KQPADSDKSDR------QQQ-----LAKHHQMRHH--------- 47
            |..:|:|....:|        ::.|:..::||      |:|     |....|.||:         
  Rat     9 SALQPEAGVCSLALPSDLQLDRRGAEGPEADRLRAARVQEQVRARLLQLGQQSRHNGSTELDGSA 73

  Fly    48 ---------QPHASEQSLNKLGLVSSGTSGMGRRKTS------------AELISEAKMFL----- 86
                     |.|..:...      ||.:.||...|||            |...|.:.:.|     
  Rat    74 ESTRGLPRGQYHTMQSGF------SSRSQGMSGDKTSTFRPIAKPAYNPASWSSRSAVDLTCSRR 132

  Fly    87 -------GESVNAVPLLATGGARLV--STRRPITPRESG----RVLYGKVALAG--RPPSAFSMR 136
                   |.:..||   ..|||:..  ...||::..|.|    |..|..::|..  ..|.....|
  Rat   133 LSSAHNGGSAFGAV---GYGGAQPTPPMPTRPVSFHERGGAASRADYDTLSLRSLRLGPGGLDDR 194

  Fly   137 Y---LQNEKPSTPRQLPALSGSVSATPMPTRNGALLCQSSTE-------------TLIELLKQH- 184
            |   .:..:|:......|.:....|:...:|.|.|....:||             ||......| 
  Rat   195 YSVVSEQLEPAAASTYRAYAYERQASSSSSRAGGLDWPEATEGPPSRTIRAPAMRTLQRFQSSHR 259

  Fly   185 ----------SGLKDCS-DETVQHINAIL-----------QELYTRVRKQERNYKRGF------- 220
                      :||:..: ..:|:.::..|           .:.||..|..:| ...||       
  Rat   260 SRGGTGSVSGAGLEPVARAPSVRSLSLSLGDSGHLPDVRGLDSYTGHRTLQR-LSSGFDDIDLPS 323

  Fly   221 -------------ILGGLYGLVECTS-------PRVLLAVARVVL----ALRVTGSNLTGACK-L 260
                         :||..|....|.|       .|.|.||.|:|.    |.:....:.|||.: |
  Rat   324 AVKYLMASDPNLQVLGAAYIQHRCYSDAAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNL 388

  Fly   261 IFKVARHEQHDALFHEHDVLELLIDGLGHASPLDEPEACIYAYGCIRFLTASSAQERDDALNRNW 325
            |:....::.  ||..|:.:.|||                            .:.:|:||.|.:|.
  Rat   389 IYDNVDNKL--ALVEENGIFELL----------------------------RTLREQDDELRKNV 423

  Fly   326 IGLETSGESQSLPIPALMPPALSAISTSLCPRKLTGQQTLVSRLARHGAVELMILHLQMLNEAGA 390
            .|:..:                           |:....|..||||....:|..|.|..|:.|| 
  Rat   424 TGILWN---------------------------LSSSDHLKDRLARDTLEQLTDLVLSPLSGAG- 460

  Fly   391 TKRLQGPPL--------HTLYQLSAAMRALADVSQQQQRLQLQLQLACPHLIRAAEVSMGELEVQ 447
                 ||||        ...|..:..:|.|:..||..:    |....|..|:             
  Rat   461 -----GPPLIQQNASEAEIFYNATGFLRNLSSASQATR----QKMRECHGLV------------- 503

  Fly   448 ANVVRTLSVLSEDSDCCETLHNYAARIGLLLGPSCAGGGQWSERLLAVLSRLGYMLGNILAKHES 512
                          |...|..|:|..:|.....|.       |..:.||..|.|.|         
  Rat   504 --------------DALVTYINHALDVGKCEDKSV-------ENAVCVLRNLSYRL--------- 538

  Fly   513 ARIQYFHNDVAMEYLLNVLEQLNERSPSSVAHLDAQIKLIRVVANMSVNPEVGAGLGNVRSLGAV 577
                                 .:|..||::..|:.:.:  |.:|.......||......|.|..:
  Rat   539 ---------------------YDEMPPSALQRLEGRGR--RDMAGAPPGEVVGCFTPQSRRLREL 580

  Fly   578 LLQLLSKTSEELTKKKSPEQQELLHA--TLGALHNLCFYQDKQAAVQPLAEGSLQSLI--DDLSA 638
            .|...:.|..|::  |.|:..|.|.:  .:|..:.|....:........|.|:||::.  |...|
  Rat   581 PLTADALTFAEVS--KDPKGLEWLWSPQIVGLYNRLLQRCELNRHTTEAAAGALQNITAGDRRWA 643

  Fly   639 SLAKVLGNCQTSVTKVELARVLGNLTRNEQARRCFCAAGGLPLMVQQLTKQAAGQDYELRTCAIG 703
            .:...|...|..:....|.||  ....:.|.|       .|..:::.|::.|..:| |:.|..:.
  Rat   644 GVLSRLALEQERILNPLLDRV--RTADHNQLR-------SLTGLIRNLSRNARNKD-EMSTKVVS 698

  Fly   704 VLVNLL--GDGEQRGPFLQLRGAELLSLLLRGSLEQEDWFLANIVCQALWNLLIDGHCAANLCQS 766
            .|:..|  ..||:..|      ||:               |.||:. .|.||::....||.    
  Rat   699 HLIEKLPGSVGEKCPP------AEV---------------LVNIIA-VLNNLVVASPIAAR---- 737

  Fly   767 SNILDEVSDLLADYLD---------EDRLSPGDDDNDNDEDDPEREAEDLDASDTDPEAHDALWE 822
                    |||  |.|         :.|.||       |.:...|.|..|.|:         ||:
  Rat   738 --------DLL--YFDGLRKLVFIKKKRDSP-------DSEKSSRAASSLLAN---------LWQ 776

  Fly   823 ------DFALV 827
                  ||..|
  Rat   777 YSKLHRDFRAV 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32668NP_727502.1 armadillo repeat 571..611 CDD:293788 10/41 (24%)
armadillo repeat 619..665 CDD:293788 11/47 (23%)
armadillo repeat 670..708 CDD:293788 8/37 (22%)
Pkp3XP_008758204.1 ARM 321..432 CDD:237987 30/167 (18%)
armadillo repeat 321..346 CDD:293788 3/24 (13%)
armadillo repeat 354..390 CDD:293788 11/35 (31%)
armadillo repeat 396..430 CDD:293788 12/90 (13%)
ARM 397..535 CDD:237987 45/238 (19%)
armadillo repeat 449..485 CDD:293788 11/41 (27%)
armadillo repeat 493..534 CDD:293788 12/78 (15%)
armadillo repeat 648..682 CDD:293788 8/42 (19%)
ARM 649..776 CDD:237987 42/188 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.