DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32668 and Pkp4

DIOPT Version :9

Sequence 1:NP_727502.1 Gene:CG32668 / 318147 FlyBaseID:FBgn0052668 Length:863 Species:Drosophila melanogaster
Sequence 2:XP_036016888.1 Gene:Pkp4 / 227937 MGIID:109281 Length:1206 Species:Mus musculus


Alignment Length:762 Identity:143/762 - (18%)
Similarity:240/762 - (31%) Gaps:270/762 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NPAEMAKQPADSDKSDRQQQLAKHHQMRHHQPHASEQSLNKLGLV-----------SSGTS-GMG 70
            |.|:..:.|.....|:...:.::.......||..:.:::.::..|           |:|.| ..|
Mouse   170 NKADSRQHPFTGSTSNHVVRTSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVTSTGVSPSRG 234

  Fly    71 RRKTSAELISEAKMFLGESVNAVPLLATG-GARLVSTRRPITPRESGRVLYGKVAL-AGRPPSAF 133
            ..:||                    |.:| |:..|:..||:.|.     .|....| |.|..|.:
Mouse   235 SLRTS--------------------LGSGFGSPSVTDSRPLNPS-----AYSSSTLPAQRAASPY 274

  Fly   134 SMRYLQNEKPSTPRQLPALSGSVSATPMPTRNGALLCQSSTETLIELLKQHSGLKDCSDETVQHI 198
            |.|      |::|..:..: |||::......||.             :.|:        :|...:
Mouse   275 SQR------PASPTAVRRV-GSVTSRQTSNPNGP-------------VPQY--------QTTTRV 311

  Fly   199 NA--ILQELYTRVRKQERNYKRGFILGGLYGLVECTSPRVLLAVARVVLALRVTGSNLTGACKLI 261
            .:  .|.:..|||....:            |.|..:||:               .|.:|...:.:
Mouse   312 GSPLTLTDAQTRVASPSQ------------GQVGSSSPK---------------RSGMTAVPQHL 349

  Fly   262 FKVARHEQHDA-LF--HEHDVLELLIDGLGHASPLDEPEACIYAYGCIRFLTASSAQERDDALNR 323
            ....:...||. .|  .::|:.|.::                              ..|.|:|. 
Mouse   350 GPSLQRTVHDMDQFGQQQYDIYERMV------------------------------PPRPDSLT- 383

  Fly   324 NWIGLETSGESQSLPIPALMPPALSAISTSLCPRKLTGQQTLVS---RLARHGAVELMILHLQML 385
               ||.:|..||.   ..|.....||:|..|....:...:|..|   |...||.||         
Mouse   384 ---GLRSSYASQH---SQLGQELRSAVSPDLHITPIYEGRTYYSPVYRSPNHGTVE--------- 433

  Fly   386 NEAGATKRLQGPPLHTLYQL-SAAMRALADVSQQQQRLQLQ-----LQLAC-------PHLIRAA 437
                    |||... .||:. |..:..|...|.|:..|..|     |..|.       |...|..
Mouse   434 --------LQGSQT-ALYRTGSVGIGNLQRTSSQRSTLTYQRNNYALNTAATYAEPYRPVQYRVQ 489

  Fly   438 EVSMGELE----VQANVVRTLSVLSEDSD---------CCET---LHNYAARIGLLLGPSCAGGG 486
            |.|...|:    ......|:.|:.|...|         |.:|   ...:|               
Mouse   490 ECSYNRLQHTGPADDGATRSPSIDSIQKDPSTLKGVIHCLQTSVVFWEFA--------------- 539

  Fly   487 QWSE-RLLAVLSRLGYMLGNILAKHESARIQYF---HNDVAME--------YLLNVLEQL----- 534
             |.: .|..|:..|.:...::.| :.:|.:|:.   .|.|.||        :|:::|:..     
Mouse   540 -WRDPELPEVIHMLQHQFPSVQA-NAAAYLQHLCFGDNKVKMEVYRLGGIKHLVDLLDHRVLEVQ 602

  Fly   535 ------------------NERSPSSVAHLDAQIKLIRVVANMSVNPEVGAGLGNVRSLGAVLLQL 581
                              |:.:..:|..:.|.::|:|...:..|...|...|.|:.|..||.:.:
Mouse   603 KNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTI 667

  Fly   582 LSKTSEELTK------------------KKSPEQQELLHATLGALHNLCFYQDKQAAVQPLAEGS 628
            :......||.                  |...:...:|..|.|.|.||....::........||.
Mouse   668 IRDALSTLTNTVIVPHSGWNNSSFDDDHKIKFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGL 732

  Fly   629 LQSLIDDLSASL------AKVLGNCQTSVT----KVEL----ARVLG 661
            :.||:..:...:      :|.:.||..::.    ::||    ||:||
Mouse   733 VDSLLYVIHTCVNTSDYDSKTVENCVCTLRNLSYRLELEVPQARLLG 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32668NP_727502.1 armadillo repeat 571..611 CDD:293788 10/57 (18%)
armadillo repeat 619..665 CDD:293788 13/57 (23%)
armadillo repeat 670..708 CDD:293788
Pkp4XP_036016888.1 Atrophin-1 72..>382 CDD:397323 53/321 (17%)
armadillo repeat 545..570 CDD:293788 6/25 (24%)
Arm 574..613 CDD:395413 6/38 (16%)
armadillo repeat 578..614 CDD:293788 4/35 (11%)
ARM 618..659 CDD:214547 9/40 (23%)
armadillo repeat 622..657 CDD:293788 7/34 (21%)
armadillo repeat 664..715 CDD:293788 7/50 (14%)
armadillo repeat 723..764 CDD:293788 7/40 (18%)
Arm 829..870 CDD:395413
armadillo repeat 840..870 CDD:293788
PLN03200 863..>984 CDD:215629
ARM 880..915 CDD:214547
armadillo repeat 882..914 CDD:293788
armadillo repeat 921..962 CDD:293788
ARM 964..1008 CDD:214547
armadillo repeat 968..1003 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.