DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp1b

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_114396.3 Gene:Mmp1b / 83996 MGIID:1933847 Length:463 Species:Mus musculus


Alignment Length:166 Identity:34/166 - (20%)
Similarity:61/166 - (36%) Gaps:24/166 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFND-YNLKMI-FSGQELFELTEPIYCQPSPP 90
            |:|..:......||...:...:...||.  .:..|.| :.:::| |..:.|.::.:.|:  |:.|
Mouse   262 PNPIQLTDATLDPCNSGLTFDAIITYRG--EVIFFKDRFYIRVISFLPEPLIDVIDLIW--PNLP 322

  Fly    91 -------RTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFTQNPKNIEHYDAYPSSDSYGPVQ 148
                   ....||...:|....:...|.|......|:...||...|.|:.:.||....:..|...
Mouse   323 GKFDAAYEVSGVDELRFFKGSKVWAVQEQNVLEGFPMDIQSFFGFPSNVTNIDAAVCEEETGKTY 387

  Fly   149 DYELPYPVWAF---KRPQAP--PR-----SPPVSYR 174
             :.:.:..|.:   .|...|  ||     .|.:.|:
Mouse   388 -FFVDHMYWRYDENTRSMDPGYPRLIAEDFPGIDYK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp1bNP_114396.3 PG_binding_1 28..84 CDD:279773
Cysteine switch. /evidence=ECO:0000250 87..94
Metalloprotease. /evidence=ECO:0000250 95..273 2/10 (20%)
Peptidase_M10 105..259 CDD:278824
ZnMc_MMP 105..259 CDD:239805
HX 273..463 CDD:238046 32/155 (21%)
Hemopexin 1 278..321 9/46 (20%)
Hemopexin 2 322..368 9/45 (20%)
Hemopexin 3 371..419 9/48 (19%)
Hemopexin 4 420..463 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.