DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp24

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_113945.1 Gene:Mmp24 / 83513 RGDID:620202 Length:618 Species:Rattus norvegicus


Alignment Length:208 Identity:45/208 - (21%)
Similarity:58/208 - (27%) Gaps:80/208 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HGDD-----------YLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSG 73
            |||.           :..||.||.....:.....|...|.:.|                    .|
  Rat   202 HGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANH--------------------DG 246

  Fly    74 QELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFTQNPKNIEHYDAY 138
            .:||                ||.| :...|...|...:.|||..:|..:...|.|.|       .
  Rat   247 NDLF----------------LVAV-HELGHALGLEHSNDPSAIMAPFYQYMETHNFK-------L 287

  Fly   139 PSSDSYG-------PVQDYE--LPYPVWAFKRPQAP----------PRSPPVSYRPPYWYYPTRR 184
            |..|..|       |.:..|  .|.|....:|..:|          |..||:..||.   .|..:
  Rat   288 PQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPS---TPGAK 349

  Fly   185 PEITKPCYGRTTT 197
            |.|   |.|...|
  Rat   350 PNI---CDGNFNT 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp24NP_113945.1 PG_binding_1 55..107 CDD:279773
Cysteine switch. /evidence=ECO:0000250 110..117
Peptidase_M10 135..300 CDD:278824 28/141 (20%)
ZnMc_MMP 135..300 CDD:239805 28/141 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..352 13/58 (22%)
HX 350..542 CDD:238046 5/13 (38%)
Hemopexin 1 350..398 5/13 (38%)
Hemopexin 2 399..444
Hemopexin 3 446..494
Hemopexin 4 495..542
DUF3377 548..618 CDD:288690
PDZ-binding 616..618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.