DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp9

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_112317.2 Gene:Mmp9 / 81687 RGDID:621320 Length:708 Species:Rattus norvegicus


Alignment Length:76 Identity:23/76 - (30%)
Similarity:28/76 - (36%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 TEPTTTTENTTTTEPTTTTEPT--TTTEPTTTTENTTTTEPTTTTEPTTTTEPT-----TTTEST 379
            ::|......||..||..|..||  .|..|........|..||....|..|..||     ..|||:
  Rat   448 SKPDPRPPATTAAEPQPTAPPTMCPTAPPMAYPTGGPTVAPTGAPSPGPTGPPTAGPSEAPTESS 512

  Fly   380 TTTERVTNTDL 390
            |..:...|.|:
  Rat   513 TPVDNPCNVDV 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp9NP_112317.2 PG_binding_1 41..95 CDD:396175
Peptidase_M10 116..445 CDD:395334
FN2 224..272 CDD:128373
FN2 282..330 CDD:128373
FN2 341..389 CDD:128373
PT 458..489 CDD:282710 9/30 (30%)
PT 475..510 CDD:282710 8/34 (24%)
HX 517..707 CDD:238046 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.