DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mur11Da and MMP27

DIOPT Version :9

Sequence 1:	NP_727652.3	Gene:	Mur11Da / 318139	FlyBaseID:	FBgn0052644	Length:	626	Species:	Drosophila melanogaster
Sequence 2:	NP_071405.2	Gene:	MMP27 / 64066	HGNCID:	14250	Length:	513	Species:	Homo sapiens

Alignment Length:	171	Identity:	32/171 - (18%)
Similarity:	44/171 - (25%)	Gaps:	82/171 - (47%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 ALTLSQGHGDDYLRFP-----DP-----------------GNIPRYNQRPCGPRV---CG----- 47
            ||.||..:....|.||     ||                 |.:|:...:|..|.:   |.
Human   221 ALGLSHSNDQTALMFPNYVSLDPRKYPLSQDDINGIQSIYGGLPKEPAKPKEPTIPHACDPDLTF 285

  Fly    48 -------------KSGHCYRSFESICD------------------------------FNDYNLKM 69
                         |..|.:|.:..|.|                              |.|.|..|
Human   286 DAITTFRREVMFFKGRHLWRIYYDITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWM 350

  Fly    70 IFSGQELFELTEPIYCQPSPPRTKLVDVG---------YYF 101
            |.....|.:..:.|:....|.|.|.:|..         |:|
Human   351 IRGYAVLPDYPKSIHTLGFPGRVKKIDAAVCDKTTRKTYFF 391

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mur11Da	NP_727652.3	None
MMP27	NP_071405.2	PG_binding_1	26..86	CDD:279773
		Cysteine switch. /evidence=ECO:0000250	89..96
		Peptidase_M10	106..261	CDD:278824	9/39 (23%)
		ZnMc_MMP	106..261	CDD:239805	9/39 (23%)
		HX	276..465	CDD:238046	19/116 (16%)
		Hemopexin 1	276..325		6/48 (13%)
		Hemopexin 2	326..371		7/44 (16%)
		Hemopexin 3	373..421		4/19 (21%)
		Hemopexin 4	422..465
		Required for retention in the endoplasmic reticulum. /evidence=ECO:0000269\|PubMed:24548619	466..513
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1565
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900