DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp8

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_071557.1 Gene:Mmp8 / 63849 RGDID:631408 Length:466 Species:Rattus norvegicus


Alignment Length:190 Identity:39/190 - (20%)
Similarity:55/190 - (28%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PYWYYPTRRPEITKPCYGRTTTATKAPVTTT--------TTTEASTTTTTIEPSTSTNAAFTTTT 232
            |.|.:    ..:|......|...:||.|.|.        :.....|.|.|:|.....|.||.:..
  Rat   107 PKWTH----TNLTYRIINHTPQMSKAEVKTEIEKAFKIWSVPSTLTFTETLEGEADINIAFVSRD 167

  Fly   233 STEASTTTTTEGTTTSTEQ------------TTTTKTTSPSTSTEILTTTTE------LTTSTEP 279
            ..:.|......|......|            :..|.|.........|....|      |:.||:|
  Rat   168 HGDNSPFDGPNGILAHAFQPGRGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDP 232

  Fly   280 --------ARTTESTTTTIADSASTIT----EQSNTTEPTTTAEPTTTTEPTTTTEPTTT 327
                    |....||.:...|..:.|.    ...|..:||..:.| |..:|....:..||
  Rat   233 GALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPVQPTGPSTP-TACDPHLRFDAATT 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp8NP_071557.1 PG_binding_1 32..87 CDD:279773
Cysteine switch. /evidence=ECO:0000250 90..97
Peptidase_M10 108..263 CDD:278824 30/158 (19%)
ZnMc_MMP 108..263 CDD:239805 30/158 (19%)
HX 277..465 CDD:238046 5/16 (31%)
Hemopexin 1 277..326 5/16 (31%)
Hemopexin 2 327..373
Hemopexin 3 375..421
Hemopexin 4 422..465
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.