DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and mmp11b

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_694153.4 Gene:mmp11b / 565793 ZFINID:ZDB-GENE-070817-2 Length:506 Species:Danio rerio


Alignment Length:166 Identity:38/166 - (22%)
Similarity:52/166 - (31%) Gaps:42/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HGDDYLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSGQELFELTEPIY 84
            || |||.|..||.|..:...|          ..||                 .|:..|::.|. :
Zfish   178 HG-DYLNFDGPGGILAHAFFP----------RTYR-----------------EGEIHFDMDES-W 213

  Fly    85 CQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFT-QNPKNIEHYDAYPSSDSYGPVQ 148
            ...:...|.|:.|.   .|....|...|.|.....:..|.:| .||..:...|.......||..:
Zfish   214 TLGNSMGTDLLQVA---THEIGHVLGLQHSKVPGAVMAPFYTFSNPVRLSEDDKRGIQALYGSKR 275

  Fly   149 DYELPYPVWAFKRPQAPPRS-------PPVSYRPPY 177
            ..|....  |.:||....|:       |||...|.:
Zfish   276 SDETVKA--AERRPTFTERNEIDATFFPPVHPNPSH 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
mmp11bXP_694153.4 Peptidase_M10 118..272 CDD:278824 27/125 (22%)
ZnMc_MMP 118..272 CDD:239805 27/125 (22%)
HX 310..500 CDD:238046 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.