DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and mmp23bb

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001017890.1 Gene:mmp23bb / 550589 ZFINID:ZDB-GENE-050417-448 Length:377 Species:Danio rerio


Alignment Length:196 Identity:39/196 - (19%)
Similarity:63/196 - (32%) Gaps:33/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSGQELFELTEPIYCQPSPPRTKLVDV-GYYFNH 103
            ||...:.|:..|.:........|:::...::  |:..|...:.::.      ..||.| .:...|
Zfish   139 PCFDGLNGELAHAFLPPRGEIHFDNHEFWIL--GKSRFSWKQGVWL------NDLVQVAAHEIGH 195

  Fly   104 RSLLVAQSQPSAYSSPIPRPSFTQNPKNIEHYDAYPSSDSYGPVQDYELPYPVWA---------- 158
            ...|.....|:|...  |..::| ..:||...|.:.....||.:....:..| ||          
Zfish   196 ALGLWHSQDPNALMH--PNATYT-GQRNIAQDDIWGIQRLYGCMDKKRVCDP-WARLGFCERRRS 256

  Fly   159 FKRPQAPPRSPPVSYRP-PYWYYPTRRPEITKPCYGRTTTATKAPVTTTTTTEASTTTTTIEPST 222
            |.:...|.|. .:.|.| .....||..||..|        ....|..........|.:|.:.|..
Zfish   257 FMKKNCPQRC-DLCYEPLDAVSTPTPPPENVK--------IKIVPRGKVVGFRCGTKSTRVPPKV 312

  Fly   223 S 223
            |
Zfish   313 S 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
mmp23bbNP_001017890.1 Peptidase_M10 67..234 CDD:278824 19/105 (18%)
ZnMc_MMP 67..234 CDD:239805 19/105 (18%)
ShK 234..269 CDD:279838 7/36 (19%)
Ig 287..358 CDD:299845 6/35 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.