Sequence 1: | NP_727652.3 | Gene: | Mur11Da / 318139 | FlyBaseID: | FBgn0052644 | Length: | 626 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017890.1 | Gene: | mmp23bb / 550589 | ZFINID: | ZDB-GENE-050417-448 | Length: | 377 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 39/196 - (19%) |
---|---|---|---|
Similarity: | 63/196 - (32%) | Gaps: | 33/196 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 PCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSGQELFELTEPIYCQPSPPRTKLVDV-GYYFNH 103
Fly 104 RSLLVAQSQPSAYSSPIPRPSFTQNPKNIEHYDAYPSSDSYGPVQDYELPYPVWA---------- 158
Fly 159 FKRPQAPPRSPPVSYRP-PYWYYPTRRPEITKPCYGRTTTATKAPVTTTTTTEASTTTTTIEPST 222
Fly 223 S 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mur11Da | NP_727652.3 | None | |||
mmp23bb | NP_001017890.1 | Peptidase_M10 | 67..234 | CDD:278824 | 19/105 (18%) |
ZnMc_MMP | 67..234 | CDD:239805 | 19/105 (18%) | ||
ShK | 234..269 | CDD:279838 | 7/36 (19%) | ||
Ig | 287..358 | CDD:299845 | 6/35 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1565 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |