DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and MMP19

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_002420.1 Gene:MMP19 / 4327 HGNCID:7165 Length:508 Species:Homo sapiens


Alignment Length:214 Identity:38/214 - (17%)
Similarity:60/214 - (28%) Gaps:90/214 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YLRFPDPGNIPRYNQR-----------PCGPRVCGKSGHCYRSFESIC--DFNDY--NLKMIFSG 73
            |:.|......|:...|           |...:|....|..|..::.:.  ||:.|  .:|.:|:|
Human   360 YINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTG 424

  Fly    74 QELFELTEPIYCQPSPPRTKLVDVGYYFN-------HRSLLVAQSQPSAYSSPIPRPSFTQNPKN 131
                     :..|||...:......|:|.       ::.|.|.:..                |:|
Human   425 ---------VPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGY----------------PRN 464

  Fly   132 IEHYDAYPSSDSYGPVQDYELPYPVWAFKRPQAPPRSPPVSYRPPYWYYPTRRPEITKPCYGRTT 196
            |.|.                     |...||:....:|.                      |..|
Human   465 ISHN---------------------WMHCRPRTIDTTPS----------------------GGNT 486

  Fly   197 TATKAPVTTTTTTEASTTT 215
            |.:...:|..||..|:.||
Human   487 TPSGTGITLDTTLSATETT 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
MMP19NP_002420.1 PG_binding_1 31..80 CDD:307564
Cysteine switch. /evidence=ECO:0000250 83..90
ZnMc_MMP 103..256 CDD:239805
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..288
HX 286..472 CDD:238046 26/157 (17%)
Hemopexin 1 286..333
Hemopexin 2 334..380 4/19 (21%)
Hemopexin 3 381..425 10/52 (19%)
Hemopexin 4 426..472 12/82 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.