DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mur11Da and MMP17

DIOPT Version :9

Sequence 1:	NP_727652.3	Gene:	Mur11Da / 318139	FlyBaseID:	FBgn0052644	Length:	626	Species:	Drosophila melanogaster
Sequence 2:	NP_057239.4	Gene:	MMP17 / 4326	HGNCID:	7163	Length:	603	Species:	Homo sapiens

Alignment Length:	45	Identity:	17/45 - (37%)
Similarity:	18/45 - (40%)	Gaps:	13/45 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   145 GPVQD---YELPYP----VWAF------KRPQAPPRSPPVSYRPP 176
            |||.|   |.|||.    ||..      ..|.|.|..||:...||
Human   272 GPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPP 316

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mur11Da	NP_727652.3	None
MMP17	NP_057239.4	PG_binding_1	47..105	CDD:279773
		Cysteine switch. /evidence=ECO:0000250	108..115
		Peptidase_M10	132..295	CDD:278824	10/22 (45%)
		ZnMc_MMP	132..295	CDD:239805	10/22 (45%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	301..329		7/16 (44%)
		HX	329..523	CDD:238046
		Hemopexin 1	333..378
		Hemopexin 2	382..427
		Hemopexin 3	428..475
		Hemopexin 4	476..523
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	537..571
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1565
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900