Sequence 1: | NP_727652.3 | Gene: | Mur11Da / 318139 | FlyBaseID: | FBgn0052644 | Length: | 626 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005932.2 | Gene: | MMP16 / 4325 | HGNCID: | 7162 | Length: | 607 | Species: | Homo sapiens |
Alignment Length: | 210 | Identity: | 48/210 - (22%) |
---|---|---|---|
Similarity: | 63/210 - (30%) | Gaps: | 67/210 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 LTALTLSQGHGDD-----------YLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFND 64
Fly 65 YNLKMIFSGQELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFTQNP 129
Fly 130 KNIEHYDAYPSSDSYGPVQDYELPYPVWAFKRP--------QAPPRSPPVSYRPPYWYYPTRRPE 186
Fly 187 I--TKP--CYGRTTT 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mur11Da | NP_727652.3 | None | |||
MMP16 | NP_005932.2 | PG_binding_1 | 42..96 | CDD:366659 | |
Cysteine switch. /evidence=ECO:0000250 | 99..106 | ||||
Peptidase_M10 | 126..291 | CDD:334067 | 27/144 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 281..340 | 17/64 (27%) | |||
PHA03247 | <292..338 | CDD:223021 | 14/51 (27%) | ||
HX | 340..532 | CDD:238046 | 4/10 (40%) | ||
Hemopexin 1 | 340..388 | 4/10 (40%) | |||
Hemopexin 2 | 389..434 | ||||
Hemopexin 3 | 436..484 | ||||
Hemopexin 4 | 485..532 | ||||
DUF3377 | 538..607 | CDD:371766 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1565 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |