DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and MMP14

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_004986.1 Gene:MMP14 / 4323 HGNCID:7160 Length:582 Species:Homo sapiens


Alignment Length:180 Identity:45/180 - (25%)
Similarity:62/180 - (34%) Gaps:42/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HGDDYLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSGQELFELTEPIY 84
            |||. ..|...|....:...| ||.:.|.:     .|:|...:...|..:  :|.::|       
Human   186 HGDS-TPFDGEGGFLAHAYFP-GPNIGGDT-----HFDSAEPWTVRNEDL--NGNDIF------- 234

  Fly    85 CQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFTQNPKNIEHYDAYPSSDSYGPVQD 149
                     ||.| :...|...|...|.|||..:|..:...|:|       ...|..|..|..|.
Human   235 ---------LVAV-HELGHALGLEHSSDPSAIMAPFYQWMDTEN-------FVLPDDDRRGIQQL 282

  Fly   150 Y--ELPYPVWAFKRPQAPPRSPPVSYRPPYWYYPTRRPEITKPCYGRTTT 197
            |  |..:|.....:|:...| |.|..:|.   .||..|.|   |.|...|
Human   283 YGGESGFPTKMPPQPRTTSR-PSVPDKPK---NPTYGPNI---CDGNFDT 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
MMP14NP_004986.1 PG_binding_1 36..88 CDD:279773
Peptidase_M10 118..284 CDD:278824 30/130 (23%)
ZnMc_MMP 118..284 CDD:239805 30/130 (23%)
HX 316..508 CDD:238046 5/13 (38%)
DUF3377 <560..582 CDD:288690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.