DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and MMP13

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_002418.1 Gene:MMP13 / 4322 HGNCID:7159 Length:471 Species:Homo sapiens


Alignment Length:166 Identity:37/166 - (22%)
Similarity:48/166 - (28%) Gaps:66/166 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HGDDYLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFND----------YNLKMIFSGQ 74
            |||.| .|..|..:..: ..|.||.. |...|          |:|          |||.::    
Human   172 HGDFY-PFDGPSGLLAH-AFPPGPNY-GGDAH----------FDDDETWTSSSKGYNLFLV---- 219

  Fly    75 ELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFTQNPKNIEHY---- 135
                                  ..:.|.|...|.....|.|...||    :|...|:  |:    
Human   220 ----------------------AAHEFGHSLGLDHSKDPGALMFPI----YTYTGKS--HFMLPD 256

  Fly   136 -DAYPSSDSYGPVQDYELPYPVWAFKRPQAPPRSPP 170
             |.......|||..  |.|.|    |.|:.|.:..|
Human   257 DDVQGIQSLYGPGD--EDPNP----KHPKTPDKCDP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
MMP13NP_002418.1 PG_binding_1 32..91 CDD:307564
Cysteine switch. /evidence=ECO:0000250 94..101
Peptidase_M10 112..267 CDD:306839 27/139 (19%)
Interaction with TIMP2 176..246 20/112 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..284 9/26 (35%)
Interaction with collagen 268..471 8/25 (32%)
HX 281..471 CDD:238046 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.