DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mur11Da and MMP10

DIOPT Version :9

Sequence 1:	NP_727652.3	Gene:	Mur11Da / 318139	FlyBaseID:	FBgn0052644	Length:	626	Species:	Drosophila melanogaster
Sequence 2:	NP_002416.1	Gene:	MMP10 / 4319	HGNCID:	7156	Length:	476	Species:	Homo sapiens

Alignment Length:	156	Identity:	29/156 - (18%)
Similarity:	41/156 - (26%)	Gaps:	84/156 - (53%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 LTALTLS---QGHGD-----------DYLRFPDPGNIPRYNQRPCGPRVCG-------------- 47
            :|.||.|   :|..|           |:..|..||:...:...| ||.:.|
Human   143 VTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPP-GPGLYGDIHFDDDEKWTEDA 206

  Fly    48 -----------KSGH----------------CYRSFESICDF----NDYN--------------- 66
                       :.||                .|.||..:..|    :|.|
Human   207 SGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEE 271

  Fly    67 ----LKMIFSGQELFELTEPIYCQPS 88
                .|.:.||.|:     |..|.|:
Human   272 PLVPTKSVPSGSEM-----PAKCDPA 292

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mur11Da	NP_727652.3	None
MMP10	NP_002416.1	PG_binding_1	33..86	CDD:307564
		Cysteine switch. /evidence=ECO:0000250	89..96
		Peptidase_M10	107..263	CDD:306839	22/120 (18%)
		HX	286..476	CDD:238046	3/7 (43%)
		Hemopexin 1	286..335		3/7 (43%)
		Hemopexin 2	336..382
		Hemopexin 3	384..432
		Hemopexin 4	433..476
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1565
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900