DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and MMP8

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_011541136.1 Gene:MMP8 / 4317 HGNCID:7175 Length:476 Species:Homo sapiens


Alignment Length:179 Identity:36/179 - (20%)
Similarity:56/179 - (31%) Gaps:53/179 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSQGHGDDYLRF--PDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSGQELFE 78
            :|||..|..:.|  .|.|:...::    ||.  |...|.::..:.|            .|...|:
Human   160 ISQGEADINIAFYQRDHGDNSPFD----GPN--GILAHAFQPGQGI------------GGDAHFD 206

  Fly    79 LTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFTQNPKNIEHYDAYPSSDS 143
             .|..:...|......:...:.|.|...|...|.|.|...|              :| |:..:.:
Human   207 -AEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYP--------------NY-AFRETSN 255

  Fly   144 YG-PVQDYELPYPVWAFKRPQAPPRSPPVSYRPPYWYYPTRRPEITKPC 191
            |. |..|.:....::...       |.|:.        || .|...|||
Human   256 YSLPQDDIDGIQAIYGLS-------SNPIQ--------PT-GPSTPKPC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
MMP8XP_011541136.1 PG_binding_1 45..95 CDD:279773
Peptidase_M10 116..271 CDD:278824 28/144 (19%)
ZnMc_MMP 116..271 CDD:239805 28/144 (19%)
HX 285..473 CDD:238046 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.