DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mur11Da and MMP3

DIOPT Version :9

Sequence 1:	NP_727652.3	Gene:	Mur11Da / 318139	FlyBaseID:	FBgn0052644	Length:	626	Species:	Drosophila melanogaster
Sequence 2:	NP_002413.1	Gene:	MMP3 / 4314	HGNCID:	7173	Length:	477	Species:	Homo sapiens

Alignment Length:	145	Identity:	29/145 - (20%)
Similarity:	42/145 - (28%)	Gaps:	66/145 - (45%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 LTALTLS---QGHGD-----------DYLRFPDPGNIPRYNQRPCGPRVCGKS------------ 49
            :|.||.|   :|..|           |:..|..|||:..:...| ||.:.|.:
Human   144 VTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAP-GPGINGDAHFDDDEQWTKDT 207

  Fly    50 -------------GH-------------CYRSFESICDFNDYNLKM--IFSGQELF--------- 77
                         ||             .|..:.|:.|...:.|..  |...|.|:
Human   208 TGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPET 272

  Fly    78 --ELTEPIYCQPSPP 90
              ..|||:..:|..|
Human   273 PLVPTEPVPPEPGTP 287

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mur11Da	NP_727652.3	None
MMP3	NP_002413.1	PG_binding_1	25..87	CDD:279773
		Cysteine switch. /evidence=ECO:0000250	90..97
		Peptidase_M10	108..264	CDD:278824	24/120 (20%)
		ZnMc_MMP	108..264	CDD:239805	24/120 (20%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	262..287		5/24 (21%)
		HX	287..477	CDD:238046	1/1 (100%)
		Hemopexin 1	287..336		1/1 (100%)
		Hemopexin 2	337..383
		Hemopexin 3	385..433
		Hemopexin 4	434..477
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1565
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900