DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mur11Da and MMP2

DIOPT Version :9

Sequence 1:	NP_727652.3	Gene:	Mur11Da / 318139	FlyBaseID:	FBgn0052644	Length:	626	Species:	Drosophila melanogaster
Sequence 2:	NP_004521.1	Gene:	MMP2 / 4313	HGNCID:	7166	Length:	660	Species:	Homo sapiens

Alignment Length:	154	Identity:	34/154 - (22%)
Similarity:	44/154 - (28%)	Gaps:	71/154 - (46%)

- Green bases have known domain annotations that are detailed below.

  Fly    96 DVGY--------YFNHRSLLVAQSQPSAYSSPIPRPSFTQN-------PKNI-EHYDAYPSSD-- 142
            |.||        .|.|...|.....|.|..:||  .::|:|       .|.| |.|.|.|..|
Human   392 DQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPI--YTYTKNFRLSQDDIKGIQELYGASPDIDLG 454

  Fly   143 -----SYGPV------QDY------ELPYPVWAFK------------RPQAP----------PRS 168
                 :.|||      ||.      ::...::.||            :|..|          |..
Human   455 TGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEK 519

  Fly   169 PPVSYRPP------------YWYY 180
            ....|..|            ||.|
Human   520 IDAVYEAPQEEKAVFFAGNEYWIY 543

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mur11Da	NP_727652.3	None
MMP2	NP_004521.1	PG_binding_1	<70..97	CDD:307564
		Cysteine switch. /evidence=ECO:0000250	100..107
		Collagenase-like 1	110..221
		Peptidase_M10	118..446	CDD:306839	15/55 (27%)
		Collagen-binding	222..396		2/3 (67%)
		FN2	226..274	CDD:128373
		FN2	284..332	CDD:128373
		FN2	342..390	CDD:128373
		Collagenase-like 2	397..465		18/69 (26%)
		Required for inhibitor TIMP2 binding. /evidence=ECO:0000269\|PubMed:1655733	414..660		28/132 (21%)
		HX	466..660	CDD:238046	12/78 (15%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1565
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900