DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp2

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_995788.1 Gene:Mmp2 / 35997 FlyBaseID:FBgn0033438 Length:758 Species:Drosophila melanogaster


Alignment Length:179 Identity:41/179 - (22%)
Similarity:62/179 - (34%) Gaps:43/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QGHGDDYLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSGQELFELTEP 82
            :.|||.| :|..||.:..:...| |.   |:.|..:  |::...:|       |.|:        
  Fly   200 RAHGDGY-KFDGPGQVLAHAFYP-GE---GRGGDAH--FDADETWN-------FDGE-------- 242

  Fly    83 IYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFTQNPKNIEHYDAYPSSDSYGPV 147
               ......|..::|..:....||.:|.   ||....:..|.:..|    |.....|..|.||..
  Fly   243 ---SDDSHGTNFLNVALHELGHSLGLAH---SAIPDAVMFPWYQNN----EVAGNLPDDDRYGIQ 297

  Fly   148 QDYELPYPVWAFKRPQAPPRSPPVS------YR---PPYWYY--PTRRP 185
            |.|......|...:||....:...:      ||   |.||.:  |:..|
  Fly   298 QLYGTKEKTWGPYKPQTTTTTTTTTTMRAMIYRADKPAYWPWNNPSNNP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp2NP_995788.1 Peptidase_M10 143..301 CDD:278824 30/132 (23%)
ZnMc_MMP 143..301 CDD:239805 30/132 (23%)
HX 513..707 CDD:238046
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.