DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and CG14913

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001097146.1 Gene:CG14913 / 34532 FlyBaseID:FBgn0032331 Length:499 Species:Drosophila melanogaster


Alignment Length:273 Identity:54/273 - (19%)
Similarity:88/273 - (32%) Gaps:76/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 YYPTRRPEITKPCYGRTTTATKAPVTTTTTTEASTTTTTIEPSTSTNAAFTTTTSTEASTTTTTE 243
            |.|:|   |:.|..|...||.                   ||....|...::...::       |
  Fly    34 YGPSR---ISAPQLGFNGTAR-------------------EPVEGDNVKISSVEHSD-------E 69

  Fly   244 GTTTSTEQTTTTKTTSPSTSTEILTTTTELTTSTEPARTTESTTTTIADSASTITEQSNTTEPTT 308
            |.|........:..:..::..:.:..|.||::                        :.::.|.:.
  Fly    70 GDTLEVSSLEHSLESKHNSKKDKIMETLELSS------------------------EHHSREKSE 110

  Fly   309 TAEPTTTTEPTTTTEPTTTTENTTTTEPTTTTEPTTTTEPTTTTENTTTTEPTTTTEPTTTTEPT 373
            |.:|:...:..:.:..|.|...|...:.||..:...||..|....|..|||   :|..|...:..
  Fly   111 TKKPSVEDKDLSDSAETMTWSTTKQIKSTTMKKTKATTYETPEMPNEITTE---STMATAIDKEK 172

  Fly   374 TTTESTTTTERVTNTDLTTTTTLLTTTKSQTSTDPSTTSSTTEPSTTTNRSSSSTTTTTVTTEPS 438
            ||.|..|.:.:...|||                 |....   |||.:..:|.||.:...||..||
  Fly   173 TTVEIYTESPKEKFTDL-----------------PGIGK---EPSDSNTQSFSSRSWEPVTPHPS 217

  Fly   439 TTTTVSSTTTTKD 451
            ........|.::|
  Fly   218 AFFDYPEATCSED 230



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.