DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and HPX

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_000604.1 Gene:HPX / 3263 HGNCID:5171 Length:462 Species:Homo sapiens


Alignment Length:152 Identity:34/152 - (22%)
Similarity:53/152 - (34%) Gaps:47/152 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GDDYLRFPDP--GNI-PRYNQ------RPCGPRVCGKSGHCYRS--------------------- 55
            |:.:||| ||  |.: |||.:      .||..|     ||.:|:                     
Human   203 GNQFLRF-DPVRGEVPPRYPRDVRDYFMPCPGR-----GHGHRNGTGHGNSTHHGPEYMRCSPHL 261

  Fly    56 FESICDFNDYNLKMIFSGQELFEL--------TEPIYCQ-PSPPRTKLVDVGYYFNHRSLLVAQS 111
            ..|....:::.....|||...:.|        :.||..| |..|  ..||..:.:..:..||..:
Human   262 VLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGP--SAVDAAFSWEEKLYLVQGT 324

  Fly   112 QPSAYSSPIPRPSFTQNPKNIE 133
            |...:.:.......:..||.:|
Human   325 QVYVFLTKGGYTLVSGYPKRLE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
HPXNP_000604.1 HX 256..460 CDD:238046 18/93 (19%)
Hemopexin 5 259..304 9/44 (20%)
Hemopexin 6 305..352 9/44 (20%)
Hemopexin 7 357..396
Hemopexin 8 400..450
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48
O-glycosylated at one site 30..40
HX 47..231 CDD:238046 10/28 (36%)
Hemopexin 1 53..93
Hemopexin 2 94..139
Hemopexin 3 140..184
Hemopexin 4 185..231 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.