DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp20

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_038931.1 Gene:Mmp20 / 30800 MGIID:1353466 Length:482 Species:Mus musculus


Alignment Length:275 Identity:53/275 - (19%)
Similarity:86/275 - (31%) Gaps:95/275 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRAFAFTVLLTALTLSQGHGDDYLRFP--DPGNIPRYNQRPCGPRVCGKSGHCYRSFESI---CD 61
            |.|::..|.|..:.::.|..|..:.|.  |.|:...::    |||  |...|.:...|.:   ..
Mouse   145 LHAWSTAVPLNFVRINSGEADIMISFETGDHGDSYPFD----GPR--GTLAHAFAPGEGLGGDTH 203

  Fly    62 F-NDYNLKMIFSGQELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSF 125
            | |.....|..:|..||.:                 ..:.|.|...|...:.|||...|..:   
Mouse   204 FDNAEKWTMGTNGFNLFTV-----------------AAHEFGHALGLGHSTDPSALMYPTYK--- 248

  Fly   126 TQNPKNIEHYDAYPSSD------SYGPVQDYELPYPVWAFKRPQAPPRSPPVSYRPPYWYYPTRR 184
            .|||....    .|..|      .|||.:.:               |..|.:.:.||:      :
Mouse   249 YQNPYRFH----LPKDDVKGIQALYGPRKIF---------------PGKPTMPHIPPH------K 288

  Fly   185 PEITKPCYGRTTTATKAPVTTTTTTEAST--------------------TTTTIEPSTSTNAAFT 229
            |.|...|            .::::.:|.|                    ..|.|.|||.|::...
Mouse   289 PSIPDLC------------DSSSSFDAVTMLGKELLFFKDRIFWRRQVHLPTGIRPSTITSSFPQ 341

  Fly   230 TTTSTEASTTTTTEG 244
            ..::.:|:......|
Mouse   342 LMSNVDAAYEVAERG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp20NP_038931.1 PG_binding_1 39..94 CDD:279773
Cysteine switch. /evidence=ECO:0000250 97..104
Peptidase_M10 115..270 CDD:278824 33/154 (21%)
ZnMc_MMP 115..270 CDD:239805 33/154 (21%)
HX 292..482 CDD:238046 11/77 (14%)
Hemopexin 1 292..342 9/61 (15%)
Hemopexin 2 343..388 2/14 (14%)
Hemopexin 3 390..438
Hemopexin 4 439..482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.