DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp20

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001100270.1 Gene:Mmp20 / 300341 RGDID:1308730 Length:482 Species:Rattus norvegicus


Alignment Length:202 Identity:43/202 - (21%)
Similarity:65/202 - (32%) Gaps:63/202 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRAFAFTVLLTALTLSQGHGDDYLRFP--DPGNIPRYNQRPCGPRVCGKSGHCYRSFESI---CD 61
            |.|::..|.|..:.::.|..|..:.|.  |.|:...::    |||  |...|.:...|.:   ..
  Rat   145 LHAWSTAVPLIFVRINSGEADIMISFETGDHGDSYPFD----GPR--GTLAHAFAPGEGLGGDTH 203

  Fly    62 F-NDYNLKMIFSGQELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSF 125
            | |.....|..:|..||.:                 ..:.|.|...|...:.|||...|..:   
  Rat   204 FDNAEKWTMGTNGFNLFTV-----------------AAHEFGHALGLGHSTDPSALMYPTYK--- 248

  Fly   126 TQNPKNIEHYDAYPSSD------SYGPVQDYELPYPVWAFKRPQAPPRSPPVSYRPPYWYYPTRR 184
            .|||....    .|..|      .|||.:.:               |..|.:.:.||:      :
  Rat   249 YQNPYRFH----LPKDDVKGIQALYGPRKTF---------------PGKPTMPHIPPH------K 288

  Fly   185 PEITKPC 191
            |.|...|
  Rat   289 PSIPDLC 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp20NP_001100270.1 PG_binding_1 39..94 CDD:279773
Peptidase_M10 115..270 CDD:278824 33/154 (21%)
ZnMc_MMP 115..270 CDD:239805 33/154 (21%)
HX 292..464 CDD:238046 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.