Sequence 1: | NP_727652.3 | Gene: | Mur11Da / 318139 | FlyBaseID: | FBgn0052644 | Length: | 626 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100270.1 | Gene: | Mmp20 / 300341 | RGDID: | 1308730 | Length: | 482 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 43/202 - (21%) |
---|---|---|---|
Similarity: | 65/202 - (32%) | Gaps: | 63/202 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LRAFAFTVLLTALTLSQGHGDDYLRFP--DPGNIPRYNQRPCGPRVCGKSGHCYRSFESI---CD 61
Fly 62 F-NDYNLKMIFSGQELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSF 125
Fly 126 TQNPKNIEHYDAYPSSD------SYGPVQDYELPYPVWAFKRPQAPPRSPPVSYRPPYWYYPTRR 184
Fly 185 PEITKPC 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mur11Da | NP_727652.3 | None | |||
Mmp20 | NP_001100270.1 | PG_binding_1 | 39..94 | CDD:279773 | |
Peptidase_M10 | 115..270 | CDD:278824 | 33/154 (21%) | ||
ZnMc_MMP | 115..270 | CDD:239805 | 33/154 (21%) | ||
HX | 292..464 | CDD:238046 | 1/4 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1565 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |