DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp15

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001099638.1 Gene:Mmp15 / 291848 RGDID:1308937 Length:657 Species:Rattus norvegicus


Alignment Length:221 Identity:54/221 - (24%)
Similarity:69/221 - (31%) Gaps:71/221 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RAFAFTVLLTALTLSQGHGDD-----------YLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSF 56
            ||.|..::|.|   |..|||.           :..||.||              .|...|.    
  Rat   188 RAEADIMVLFA---SGFHGDSSPFDGVGGFLAHAYFPGPG--------------LGGDTHF---- 231

  Fly    57 ESICDFNDYNLKMIFSGQELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIP 121
                   |.:....||..:|..::           ..||.| :...|...|...|.|||..:|..
  Rat   232 -------DADEPWTFSSTDLHGIS-----------LFLVAV-HELGHALGLEHSSNPSAIMAPFY 277

  Fly   122 RPSFTQNPKNIEHYDAYPSSDSYGPVQDY---------ELPYPVWAFKRPQAPPRSPPVSYRPPY 177
            :...|.|.:       .|..|..|..|.|         ..|.|....:||..|...||   |||.
  Rat   278 QWMDTDNFQ-------LPEDDLRGIQQLYGSPDGKPQPTRPLPTVRPRRPGRPDHQPP---RPPQ 332

  Fly   178 WYYPTRRPE-ITKPCYGRTTTATKAP 202
            ..:|..:|| ..||.......||:.|
  Rat   333 PPHPGGKPERPPKPGPPPQPRATERP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp15NP_001099638.1 PG_binding_1 42..102 CDD:279773
Peptidase_M10 135..300 CDD:278824 35/158 (22%)
ZnMc_MMP 135..300 CDD:239805 35/158 (22%)
HX 363..555 CDD:238046
DUF3377 <632..657 CDD:288690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.