DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp11

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_037112.2 Gene:Mmp11 / 25481 RGDID:3099 Length:491 Species:Rattus norvegicus


Alignment Length:79 Identity:24/79 - (30%)
Similarity:33/79 - (41%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 SPPVSYRPPYWYYPTRRPEITKPCYGRTTTATKAPVTTTTTTEASTTTTTI---EPSTSTNAAFT 229
            ||..::|.|....|..|..| :..|||......:| |.|.:::|.|.|..|   ||.......  
  Rat   237 SPFYTFRYPLSLSPDDRRGI-QHLYGRPQLTPTSP-TPTLSSQAGTDTNEIALQEPEVPPEVC-- 297

  Fly   230 TTTSTEASTTTTTE 243
             .||.:|.:|...|
  Rat   298 -ETSFDAVSTIRGE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp11NP_037112.2 Cysteine switch. /evidence=ECO:0000250 82..89
Peptidase_M10 108..261 CDD:395334 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..279 6/19 (32%)
HX 294..483 CDD:238046 5/20 (25%)
Hemopexin 1 298..342 5/13 (38%)
Hemopexin 2 343..385
Hemopexin 3 387..435
Hemopexin 4 436..483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.