DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mur11Da and Mmp17

DIOPT Version :9

Sequence 1:	NP_727652.3	Gene:	Mur11Da / 318139	FlyBaseID:	FBgn0052644	Length:	626	Species:	Drosophila melanogaster
Sequence 2:	NP_035976.3	Gene:	Mmp17 / 23948	MGIID:	1346076	Length:	578	Species:	Mus musculus

Alignment Length:	62	Identity:	21/62 - (33%)
Similarity:	24/62 - (38%)	Gaps:	22/62 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly   137 AYPSS--DSY--GPVQD---YELPYP----VW---AFKRPQAP--------PRSPPVSYRPP 176
            |.|||  ..|  |||.|   |.|||.    ||   ..:...:|        |..||:...||
Mouse   259 AAPSSIMQPYYQGPVGDPLRYGLPYEDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLPEPP 320

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mur11Da	NP_727652.3	None
Mmp17	NP_035976.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..22
		PG_binding_1	44..104	CDD:279773
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	107..133
		Cysteine switch. /evidence=ECO:0000250	107..114
		Peptidase_M10	131..294	CDD:278824	15/34 (44%)
		ZnMc_MMP	131..294	CDD:239805	15/34 (44%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	301..334		6/20 (30%)
		HX	333..527	CDD:238046
		Hemopexin 1	333..382
		Hemopexin 2	386..432
		Hemopexin 3	436..479
		Hemopexin 4	480..527
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1565
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900