powered by:
Protein Alignment Mur11Da and Mmp17
DIOPT Version :9
Sequence 1: | NP_727652.3 |
Gene: | Mur11Da / 318139 |
FlyBaseID: | FBgn0052644 |
Length: | 626 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_035976.3 |
Gene: | Mmp17 / 23948 |
MGIID: | 1346076 |
Length: | 578 |
Species: | Mus musculus |
Alignment Length: | 62 |
Identity: | 21/62 - (33%) |
Similarity: | 24/62 - (38%) |
Gaps: | 22/62 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 AYPSS--DSY--GPVQD---YELPYP----VW---AFKRPQAP--------PRSPPVSYRPP 176
|.||| ..| |||.| |.|||. || ..:...:| |..||:...||
Mouse 259 AAPSSIMQPYYQGPVGDPLRYGLPYEDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLPEPP 320
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1565 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.