DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Vtn

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_035837.1 Gene:Vtn / 22370 MGIID:98940 Length:478 Species:Mus musculus


Alignment Length:162 Identity:35/162 - (21%)
Similarity:58/162 - (35%) Gaps:37/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RSFESICDFNDYNLKMIFSGQELFELTEPIYCQPSPPRTKLVD--------VGYYFNH-----RS 105
            :.|::..|..:.:| ..|.||..:||.|.. .:|..|  ||:.        :...|..     ::
Mouse   158 KPFDAFTDLKNGSL-FAFRGQYCYELDETA-VRPGYP--KLIQDVWGIEGPIDAAFTRINCQGKT 218

  Fly   106 LLVAQSQPSAYSSPIPRPSFTQNPKNI-EHYDAYPSSDSYG---PVQDYELPYPVWAFKRPQAPP 166
            .|...||...:...:..|.:   |:|| |.:...|.:....   |...|.....|:.||..|   
Mouse   219 YLFKGSQYWRFEDGVLDPGY---PRNISEGFSGIPDNVDAAFALPAHRYSGRERVYFFKGKQ--- 277

  Fly   167 RSPPVSYRPPYWYYPTRRPEITKPCYGRTTTA 198
                      ||.|..::....:.|.|.:.:|
Mouse   278 ----------YWEYEFQQQPSQEECEGSSLSA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
VtnNP_035837.1 SO 20..62 CDD:197571
Cell attachment site 64..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..153
HX 153..473 CDD:238046 35/162 (22%)
Hemopexin 1 157..201 13/46 (28%)
Hemopexin 2 202..249 9/49 (18%)
Hemopexin 3 250..304 13/63 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..395
Heparin-binding. /evidence=ECO:0000250 366..399
Hemopexin 4 420..473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.