DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and ZC513.3

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_505073.1 Gene:ZC513.3 / 191195 WormBaseID:WBGene00022628 Length:619 Species:Caenorhabditis elegans


Alignment Length:311 Identity:59/311 - (18%)
Similarity:92/311 - (29%) Gaps:100/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HC------------YRSFESICDFNDYNLKMIFSGQELFELTEPIYCQPSPPR-TKLVDVGYYFN 102
            ||            |..|.:|...| ||     ||.:| :||.|    .:|.| ..:|.|     
 Worm   339 HCKLKTLIRVRTSRYAHFPAISVVN-YN-----SGNQL-QLTIP----RTPKRPPSIVTV----- 387

  Fly   103 HRSLLVAQSQPSAYSSPIPRPSFTQNPKN-----------IEHYDAYPSSDSYGPVQDYELPYPV 156
                       |.|||.....:.|..|.:           :||...:....|...||        
 Worm   388 -----------SGYSSDSANSAGTDTPLDWELDWKLTDTVMEHQMTFTGDTSRCSVQ-------- 433

  Fly   157 WAFKRPQAPPRSPPVSYRPPYWYYPTRRPEITKPCYGRTTTATKAPVTTTTTTEASTTTTTIEPS 221
                      |:...::....|...|||.::......|.......|:        ....||:.||
 Worm   434 ----------RAAEKNFNRRKWREMTRRKQLLFKADSRFELQDTVPI--------FKQLTTMHPS 480

  Fly   222 --------TSTNAAFTTTTSTEASTTTTTEGTTTSTEQTTTT---KTTSPSTSTEILTT----TT 271
                    ...|......:|.::...:..:..|:...|...|   ||......|:|:.|    |.
 Worm   481 LIYCKLRGMELNKLVRRQSSEKSDAPSVAQSATSYLFQQRITFLEKTLPSKNDTKIVLTPGWRTF 545

  Fly   272 ELTTSTEP----ARTTESTTTTIADSASTITEQSNTTEPTTTAEPTTTTEP 318
            .:...:|.    :|.....|:.::.:..:    .:.|.|.....|.|...|
 Worm   546 AIREKSEKFPNVSRILRQKTSWVSKNCMS----RSATVPRCDKLPMTVEVP 592



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.