DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and zmp-1

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_741156.1 Gene:zmp-1 / 175839 WormBaseID:WBGene00006987 Length:521 Species:Caenorhabditis elegans


Alignment Length:111 Identity:25/111 - (22%)
Similarity:41/111 - (36%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLLTALTLSQGHGDDYLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSG 73
            :|...:||......|:.:|     :.:|...        .||....|.||:.|... |::.:...
 Worm    11 ILFLLVTLKIAQNVDHTKF-----LQKYGYL--------TSGDNQLSSESLSDALK-NMQRMAGL 61

  Fly    74 QELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSP 119
            :|..||.|........||....||.   :|:     :|:...|:.|
 Worm    62 EETGELDERTIQMMERPRCGHPDVE---DHQ-----KSRGKRYAPP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
zmp-1NP_741156.1 PG_binding_1 28..75 CDD:307564 13/60 (22%)
ZnMc_MMP 102..257 CDD:239805
HX 308..483 CDD:238046
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.