DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp16

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001366447.1 Gene:Mmp16 / 17389 MGIID:1276107 Length:607 Species:Mus musculus


Alignment Length:213 Identity:48/213 - (22%)
Similarity:63/213 - (29%) Gaps:73/213 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTALTLSQGHGDD-----------YLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFND 64
            :|.:..|..|||.           :..||.||.....:.....|...|...|             
Mouse   184 ITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNH------------- 235

  Fly    65 YNLKMIFSGQELFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRPSFTQNP 129
                   .|.:||                ||.| :...|...|...:.|:|..:|..:...|.|.
Mouse   236 -------DGNDLF----------------LVAV-HELGHALGLEHSNDPTAIMAPFYQYMETDNF 276

  Fly   130 KNIEHYDAYPSSDSYGPVQDYELPYPVWAFKRP--------QAPPRSP-----PVSYRPPYW--Y 179
            | :.:.|.......|||..  ::|.|.    ||        ..||..|     |...|||..  .
Mouse   277 K-LPNDDLQGIQKIYGPPD--KIPPPT----RPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPS 334

  Fly   180 YPTRRPEITKPCYGRTTT 197
            ||..:|.|   |.|...|
Mouse   335 YPGAKPNI---CDGNFNT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp16NP_001366447.1 PG_binding_1 46..96 CDD:396175
Cysteine switch. /evidence=ECO:0000250 99..106
Peptidase_M10 126..291 CDD:395334 27/144 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..340 17/64 (27%)
PHA03247 <292..338 CDD:223021 14/51 (27%)
HX 340..532 CDD:238046 5/13 (38%)
Hemopexin 1 340..388 5/13 (38%)
Hemopexin 2 389..434
Hemopexin 3 436..484
Hemopexin 4 485..532
DUF3377 537..607 CDD:403153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.