DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and Mmp12

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_446415.2 Gene:Mmp12 / 117033 RGDID:620195 Length:477 Species:Rattus norvegicus


Alignment Length:242 Identity:49/242 - (20%)
Similarity:70/242 - (28%) Gaps:72/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTALTLSQGHGDDYLRFPDPGNIPRYNQRPCGPRVCGKSGHCYRSFESICDFNDYNLKMIFSGQE 75
            :|.|.....|||.| .|...|....:...| ||.:.| ..|...:......|...||.::    .
  Rat   167 ITILFAFGDHGDFY-DFDGKGGTLAHAFYP-GPGIQG-DAHFDEAETWTKSFQGTNLFLV----A 224

  Fly    76 LFELTEPI-----------------YCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSAYSSPIPRP 123
            :.||...:                 |..|:..|....|:            .|..|.|.:|:..|
  Rat   225 VHELGHSLGLPHSNNPKSIMYPTYRYLHPNTFRLSADDI------------HSIQSLYGAPVKNP 277

  Fly   124 SFT---QNPKNIEHYDAYPSSDSYGPVQDYELPYPVWAF--KRPQAP--------------PRSP 169
            |.|   ..|..:.|...  |.|:...|.|....:..|.|  :.|.:|              |...
  Rat   278 SLTNPGSPPSTVCHQSL--SFDAVTTVGDKIFFFKDWFFWWRLPGSPATNITSISSMWPTIPSGI 340

  Fly   170 PVSYR------------PPYWYYPTRRPEITKPCYGRTTTATKAPVT 204
            ..:|.            ..||......||   |.|.|:..:...|.:
  Rat   341 QAAYEIGGRNQLFLFKDEKYWLINNLVPE---PHYPRSIHSLGFPAS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
Mmp12NP_446415.2 PG_binding_1 41..95 CDD:279773
Peptidase_M10 116..271 CDD:278824 24/122 (20%)
ZnMc_MMP 116..271 CDD:239805 24/122 (20%)
HX 293..477 CDD:238046 18/97 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.