DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur11Da and mmp25a

DIOPT Version :9

Sequence 1:NP_727652.3 Gene:Mur11Da / 318139 FlyBaseID:FBgn0052644 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_021327128.1 Gene:mmp25a / 100001739 ZFINID:ZDB-GENE-070820-22 Length:514 Species:Danio rerio


Alignment Length:190 Identity:39/190 - (20%)
Similarity:60/190 - (31%) Gaps:50/190 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LTLSQGHGDDYLRFPDPGNIPRYNQRPCGPRVCGK---SGHCYRSFESICDFNDYNLKMIFSGQE 75
            :|.:.|:.:|...|...|....:...|      ||   :|..:...|....:.|::     |..:
Zfish   122 VTFTSGYHEDGYPFDGKGGALAHAFFP------GKGDLAGDTHFDAEESWTYGDWS-----SDSD 175

  Fly    76 LFELTEPIYCQPSPPRTKLVDVGYYFNHRSLLVAQSQPSA-----YSSPIPRPSFTQNPKNIEHY 135
            ||.:..                 :.|.|...|...|...:     |.||:..    .|..::...
Zfish   176 LFTVAV-----------------HEFGHALGLFHSSSSDSIMKPYYFSPVGE----MNSYSLTAV 219

  Fly   136 DAYPSSDSYGPVQDYELPYPVWAFKRPQAPPRSPPVSY--RPPYWYYPTRRPEITKPCYG 193
            |.......||...:.:.|..|.|   |...|.....:|  .||  |||   |:....|.|
Zfish   220 DRLGIQALYGKQHNLKPPPSVAA---PTTYPTQFSTTYLLHPP--YYP---PDSADRCQG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur11DaNP_727652.3 None
mmp25aXP_021327128.1 ZnMc_MMP 61..229 CDD:239805 23/138 (17%)
HX 267..466 CDD:238046 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.