DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and cbpA

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_415520.1 Gene:cbpA / 947572 ECOCYCID:EG12193 Length:306 Species:Escherichia coli


Alignment Length:103 Identity:34/103 - (33%)
Similarity:52/103 - (50%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            :|||.|:||......:.|:.||:|:|..||||.:|.|...|:|:::.||:.||||...|.:||  
E. coli     4 KDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYD-- 66

  Fly    68 VMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTV 105
               ....|..:...|...:..:|.........|.||::
E. coli    67 ---QMWQHRNDPQFNRQFHHGDGQSFNAEDFDDIFSSI 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 26/60 (43%)
cbpANP_415520.1 PRK10266 1..306 CDD:182347 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
21.910

Return to query results.
Submit another query.