DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and JJJ2

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_012373.2 Gene:JJJ2 / 853277 SGDID:S000003698 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:141 Identity:37/141 - (26%)
Similarity:64/141 - (45%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDASVM 69
            ||.|||:..|||..|:.::|.::|.:.||||.|..::...|:.:..|.::|:|...:.:||..:.
Yeast    14 YYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILTDEDQKLRYDRDLK 78

  Fly    70 LSRRAHT---TNNSH-------NSGGYQP----NGSYEREMKTSDTFSTVCAVGGVLVGLFLGFG 120
            : :..||   ..|.|       .|.|..|    :.:|.|:.|..:...             .|||
Yeast    79 I-KGLHTYQPKKNCHIFKTKAKESQGASPTLGQSEAYHRQNKPYEQQP-------------YGFG 129

  Fly   121 AFKALSGSNNN 131
            ..|.::.|:.:
Yeast   130 VGKKMTSSSKS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 20/59 (34%)
JJJ2NP_012373.2 DnaJ 13..74 CDD:395170 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.