powered by:
Protein Alignment CG32641 and AT1G77930
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_565163.1 |
Gene: | AT1G77930 / 844128 |
AraportID: | AT1G77930 |
Length: | 271 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 25/71 - (35%) |
Similarity: | 39/71 - (54%) |
Gaps: | 7/71 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPD-------KNKHPRTTAQFRKINEAFNVLSDAS 59
|:..|..|.:|.||.:|:|:.||:|:|..|||| ..:.....|:|.||..|:.:|.|:.
plant 74 EKSPYDTLELDRNAEEEQIKVAYRRLAKFYHPDVYDGKGTLEEGETAEARFIKIQAAYELLMDSE 138
Fly 60 ARRKYD 65
.:.:||
plant 139 KKVQYD 144
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.