DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AT1G74250

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_177565.1 Gene:AT1G74250 / 843765 AraportID:AT1G74250 Length:630 Species:Arabidopsis thaliana


Alignment Length:94 Identity:34/94 - (36%)
Similarity:50/94 - (53%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMILGVDHNATDEEIRRAYKRMALIYHPDK------NKHPRTTAQFRKINEAFNVLSDASARRK 63
            :|.:||:...::.:|||.:|:|:||..||||      ......||||:::..|:.||||...|..
plant    12 HYEVLGISKESSPDEIRSSYRRLALQRHPDKLMKAAGLSEAEATAQFQELVHAYEVLSDPKERAW 76

  Fly    64 YDASVMLSRRAHTTNNSHNS-GGYQPNGS 91
            ||     |.|:......|:| ||.:..||
plant    77 YD-----SHRSQILFADHSSAGGSKSGGS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 24/65 (37%)
AT1G74250NP_177565.1 DnaJ 11..78 CDD:278647 24/65 (37%)
zf-C2H2_jaz 307..333 CDD:288983
C2H2 Zn finger 310..332 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.