DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AT1G61770

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_176370.2 Gene:AT1G61770 / 842474 AraportID:AT1G61770 Length:300 Species:Arabidopsis thaliana


Alignment Length:124 Identity:40/124 - (32%)
Similarity:62/124 - (50%) Gaps:16/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            ||.|.:|||..:|...:|:|:|.:::|.:|||||..|.:...|.||..|:.:|.|.:.|.:||.:
plant    33 EDCYALLGVAQDANASDIKRSYYKLSLQHHPDKNPDPESRKLFVKIATAYEILKDNTTRAQYDYA 97

  Fly    68 VMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFGAFKALS 126
            :     .|.....:|:..|. ...|..:   ||.       ..|||||.:...||:.|:
plant    98 I-----EHPEEVFYNTAQYY-RAKYGHK---SDP-------RAVLVGLLVVLSAFQYLN 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 23/60 (38%)
AT1G61770NP_176370.2 DnaJ 34..95 CDD:395170 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.